Updates to the Pto DC3000 chromosome sequence and annotation:
Locus | Date: Nature of change | Source | |
2901-3360 | 06-16-10: Qualifiers of 460 CDS features changed to reflect both RNA transcript and peptide sequencing Product names for 33 "conserved hypothetical protein" changed to "conserved protein of unknown function" |
M. Filiatrault USDA-ARS |
|
345-2900 | 06-16-10: Qualifiers of 2555 CDS features changed to reflect RNA transcript sequencing Product names for 486 "conserved hypothetical protein" changed to "conserved protein of unknown function" |
M. Filiatrault USDA-ARS |
|
344 | PSPTO_5671 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
343 | PSPTO_5670 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
342 | PSPTO_5669 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
341 | PSPTO_5668 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
340 | PSPTO_5671 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
339 | PSPTO_5670 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
338 | PSPTO_5669 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
337 | PSPTO_5668 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
336 | PSPTO_5667 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
335 | PSPTO_5666 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
334 | PSPTO_5665 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
333 | PSPTO_5664 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
332 | PSPTO_5663 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
331 | PSPTO_5662 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
330 | PSPTO_5661 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
329 | PSPTO_5660 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
328 | PSPTO_5659 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
327 | PSPTO_5658 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
326 | PSPTO_5657 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
325 | PSPTO_5656 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
324 | PSPTO_5655 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
323 | PSPTO_5654 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
322 | PSPTO_5653 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
321 | PSPTO_5652 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
320 | PSPTO_5651 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
319 | PSPTO_5650 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
318 | PSPTO_5649 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
317 | PSPTO_5648 | 03-23-10: Gene/ncRNA feature added |
M. Filiatrault USDA-ARS |
316 | PSPTO_5647 | 03-23-10: Gene/ncRNA feature added FT ncRNA 555344..555465 FT /locus_tag="PSPTO_5647" FT /product=”rsmY” FT /ncRNA_class=”scRNA” FT /experiment="RNA sequencing" FT /inference="nucleotide motif:RFAM:RF00195" FT /note="see PMID:20190049 for expression data" |
M. Filiatrault USDA-ARS |
315 | PSPTO_5646 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
314 | PSPTO_5645 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
313 | PSPTO_5644 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
312 | PSPTO_5643 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
311 | PSPTO_5642 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
310 | PSPTO_5641 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
309 | PSPTO_5640 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
308 | PSPTO_5639 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
307 | PSPTO_5638 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
306 | PSPTO_2108 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
305 | PSPTO_5637 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
304 | PSPTO_5635 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
303 | PSPTO_5634 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
302 | PSPTO_5636 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
301 | PSPTO_0391 | 03-23-10: Gene/CDS feature added |
M. Filiatrault USDA-ARS |
300 | PSPTO_5633 | 03-23-10: Gene/CDS feature added FT CDS 15948..16421 FT /codon_start=1 FT /transl_table=11 FT /locus_tag="PSPTO_5633" FT /product="conserved protein of unknown function" FT /inference="ab initio prediction:Easygene 1.2" FT /experiment="peptide sequencing" FT /note="see PMID:20190049 for expression data" |
M. Filiatrault USDA-ARS |
299 | PSPTO_4705 | 03-23-10: CDS feature added |
M. Filiatrault USDA-ARS |
298 | PSPTO_3477 | 03-23-10: Gene/CDS feature changed complement(3924034..3924501) /product="protein of unknown function" /inference="ab initio prediction:Easygene 1.2" /experiment="RNA sequencing, peptide sequencing"FT /note="PMID:20190049" |
M. Filiatrault USDA-ARS |
297 | PSPTO_2108 | 03-23-10: Gene/CDS feature changed complement(2283419..2284006) /product="protein of unknown function" /inference="ab initio prediction:Easygene 1.2" /experiment="RNA sequencing, peptide sequencing"FT /note="PMID:20190049" |
M. Filiatrault USDA-ARS |
296 | PSPTO_1500 | 03-23-10: Gene/CDS feature changed 1657245..1658126 /product="protein of unknown function" /inference="ab initio prediction:Easygene 1.2" /experiment="RNA sequencing, peptide sequencing"FT /note="PMID:20190049" |
M. Filiatrault USDA-ARS |
295 | PSPTO_0392 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
294 | PSPTO_1113 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
293 | PSPTO_1442 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
292 | PSPTO_1837 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
291 | PSPTO_2357 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
290 | PSPTO_2512 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
289 | PSPTO_2619 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
288 | PSPTO_2682 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
287 | PSPTO_3093 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
286 | PSPTO_4311 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
285 | PSPTO_5429 |
03-23-10: Gene/CDS feature deleted gene call inconsistent with transcriptome mapping |
M. Filiatrault USDA-ARS |
266-284 | multiple | 09-15-09: 19 PvdS box promoter features added Formatting consistent with 2009 DDBJ/EMBL/Genbank guidelines: /bound_moiety="PvdS" /inference="nucleotide motif:PvdS_box_model_C_DC3000.hmm" /experiment="PvdS-dependent reporter activity and/or RT-PCR " /note=[PubMed ID] |
B. Swingle USDA-ARS |
215-265 | multiple | 09-15-09: 51 Hrp box promoter features changed |
D. Schneider USDA-ARS |
214 | PSPTO_1407 | 12-22-08: Gene/CDS feature restored complement(1547545..1548381) /locus_tag="PSPTO_1407" /product="ISPssy transposase or derivative" |
M. Lindeberg Cornell University |
213 | PSPTO_1949 | 12-22-08: Gene name added /gene="fliC" |
M. Lindeberg Cornell University |
212 | PSPTO_4655 | 03-19-08: Gene/CDS feature deleted | M. Lindeberg Cornell University |
211 | PSPTO_0122 | 03-19-08: Gene/CDS feature deleted | M. Lindeberg Cornell University |
210 | PSPTO_4085 | 03-19-08: Gene/CDS feature deleted | M. Lindeberg Cornell University |
209 | PSPTO_4086 | 03-19-08: Gene/CDS feature deleted | M. Lindeberg Cornell University |
208 | PSPTO_5042 | 03-19-08: Gene/CDS feature deleted | M. Lindeberg Cornell University |
207 | PSPTO_3622 | 03-19-08: Gene/CDS feature deleted | M. Lindeberg Cornell University |
206 | PSPTO_3623 | 03-19-08: Gene/CDS feature deleted | M. Lindeberg Cornell University |
205 | PSPTO_5269 | 03-19-08: Gene name, product name, and note changed /gene="betT" /product="choline transporter" /note="see PMID: 18156257" |
M. Lindeberg Cornell University Based on literature review |
204 | PSPTO_1378 | 03-19-08: Gene name, product name, and note changed /gene="hrpH" /product="membrane-bound lytic murein transglycosylase D" /note="see PMID: 17827286" |
M. Lindeberg Cornell University Based on literature review |
203 | PSPTO_4710 | 03-19-08: Gene name, product name, and note changed /gene="cmaB" /product="coronamic acid synthetase CmaB" /note="member of the non-heme alpha-ketoglutarate-dependent enzyme superfamily; exhibits halogenase activity, chlorinating the gamma-position of L-allo-isoleucine during coronamic acid biosynthesis; see PMID: 16121186" |
M. Lindeberg Cornell University Based on literature review |
202 | PSPTO_4711 | 03-19-08: Gene name, product name, and note changed /gene="cmaC" /product="coronamic acid synthetase CmaC" /note="catalyses formation of the cyclopropyl ring from the gamma-Cl-L-allo-isoleucine product of the CmaB reaction during coronamic acid biosynthesis; see PMID: 16121186" |
M. Lindeberg Cornell University Based on literature review |
201 | PSPTO_4707 | 03-19-08: Gene name, product name, and note changed /gene="cmaD" /product="coronamic acid synthetase CmaD" /note="non-ribosomal peptide synthetase thiolation domain; aminoacylated by adenylation domain of CmaA in the presence of CmaE during coronamic acid biosynthesis; see PMID: 16121186" |
M. Lindeberg Cornell University Based on literature review |
200 | PSPTO_4708 | 03-19-08: Gene name, product name, and note changed /gene="cmaE" /product="coronamic acid synthetase CmaED" /note="acetyletransferase; shuttles amino acid group between thiolation domains of CmaA and CmaD during coronamic acid biosynthesis; see PMID: 16121186" |
M. Lindeberg Cornell University Based on literature review |
199 | PSPTO_4709 | 03-19-08: Product name, and note changed /product="coronamic acid synthetase CmaA" /note="non-ribosomal peptide synthetase with adenylation and thiolation domains; reacts with the AMP derivative of L-allo-isoleucine to produce an aminoacyl thiolester intermediate during coronamic acid biosynthesis; see PMID: 14679222" |
M. Lindeberg Cornell University Based on literature review |
198 | PSPTO_0442 | 03-19-08: Gene name, and note changed /gene="betB" /product="betaine aldehyde dehydrogenase BADH" |
M. Lindeberg Cornell University Based on literature review |
197 | PSPTO_4794 | 03-19-08: CDS feature added and pseudogene designation removed /gene="rluE" /product="ribosomal large subunit pseudouridine synthase E" /note="identified by similarity to SP:P75966; match to protein family HMM PF00849; match to protein family HMM TIGR00093" |
G. Preston Oxford University |
196 | PSPTO_1815 | 03-19-08: CDS feature added and pseudogene designation removed /gene="rluB" /product="ribosomal large subunit pseudouridine synthase B" /note="identified by similarity to SP:P37765; match to protein family HMM PF00849; match to protein family HMM PF01479; match to protein family HMM TIGR00093" |
G. Preston Oxford University |
195 | PSPTO_2349 | 03-19-08: CDS feature added and pseudogene designation removed /product="RNA pseudouridine synthase family protein" /note="identified by match to protein family HMM PF00849" |
G. Preston Oxford University |
194 | PSPTO_0160 | 11-26-07: Gene/CDS feature deleted | D.
Schneider, USDA-ARS |
193 | PSPTO_4783 | 11-26-07: Gene/CDS feature deleted | D.
Schneider, USDA-ARS |
192 | PSPTO_5631 | 11-26-07: Gene/CDS feature created |
D.
Schneider, USDA-ARS |
191 | PSPTO_5632 | 11-26-07: Gene/CDS feature created gene 5376643..5378961 /locus_tag="PSPTO_5632" CDS 5376643..5378961 /locus_tag="PSPTO_5632" /inference=”similar to AA sequence:RefSeq: ZP_01715308.1" /codon_start=1 /transl_table=11 /product="hypothetical protein" |
D.
Schneider, USDA-ARS |
190 | PSPTO_5457 | 11-26-07: Gene name, product name, and note changed - Inference added |
M. Lindeberg |
189 | 11-26-07: Miscellaneous feature created |
M. Lindeberg Cornell University |
|
188 | PSPTO_2828 | 11-26-07: Gene name, product name, and note changed /gene="syrR" /product="transcriptional regulator SyrR" /note="required for syringofactin-induced swarming motility and droplet collapse. See PMID:17601782" |
M. Lindeberg Cornell University Based on literature review |
187 | PSPTO_2829 | 11-26-07: Gene name, product name, and note changed /gene="syfA" /product="non-ribosomal peptide synthetase SyfA" /note="This gene consists of three complete condensation, adenylation, thiolation domain modules. The adenylation domains are specific for leucine, leucine and glutamine; together with PSPTO_2830 codes for proteins involved in production of lipopeptide syringofactins. See PMID:17601782" |
M. Lindeberg Cornell University Based on literature review |
186 | PSPTO_2830 | 11-26-07: Gene name, product name, and note changed /gene="syfB" /product="non-ribosomal peptide synthetase SyfB" /note="This gene consists of five complete condensation, adenylation, thiolation domain modules followed by two thioesterase domains. The adenylation domains are specific for leucine, threonine, valine, leucine and leucine; together with PSPTO_2829 codes for proteins involved in production of lipopeptide syringofactins. See PMID:17601782" |
M. Lindeberg Cornell University Based on literature review |
185 | PSPTO_2831 | 11-26-07: Gene name, product name, and note changed /gene="syfC" /product="syringolide efflux protein SyfC" /note="see PMID:17601782" |
M. Lindeberg Cornell University Based on literature review |
184 | PSPTO_2832 | 11-26-07: Gene name, product name, and note changed /gene="syfD" /product="syringolide efflux protein SyfD" /note="see PMID:17601782" |
M. Lindeberg Cornell University Based on literature review |
183 | PSPTO_4575 | 11-26-07: Gene name, product name, and note changed /gene="opuCA" /product="glycine betaine/choline OpuC ABC transporter, ATP-binding protein" /note="see PMID:17660277" |
M. Lindeberg Cornell University Based on literature review |
182 | PSPTO_3549 | 11-26-07: Gene name, product name, and note changed /gene="aefR" /product="transcriptional regulator AefR" /note="see PMID:17400767" |
M. Lindeberg Cornell University Based on literature review |
181 | PSPTO_4576 | 11-26-07: Product name, and note changed /product="glycine betaine/choline OpuC ABC transporter, permease protein" /note="see PMID:17660277" |
M. Lindeberg Cornell University Based on literature review |
180 | PSPTO_4577 | 11-26-07: Product name, and note changed /product="glycine betaine/choline OpuC ABC transporter, periplasmic substrate-binding protein" /note="see PMID:17660277" |
M. Lindeberg Cornell University Based on literature review |
179 | PSPTO_3332 | 11-26-07: Product name changed and inference added /product="alkaline metalloendoprotease" /inference="similar to AA sequence:RefSeq:YP_607222" |
M. Lindeberg Cornell University |
178 | PSPTO_4868 | 11-26-07: Product name changed and inference added /product="sensor histidine kinase/response regulator RetS" /inference="similar to AA sequence:INSD: AAG08241.1" |
M. Lindeberg Cornell University |
177 | PSPTO_3529 | 11-26-07: Product name changed and inference added /product="capsular polysaccharide biosynthesis protein PslA" /inference="similar to AA sequence:INSD:AAG05619.1" |
M. Lindeberg Cornell University |
176 | PSPTO_3530 | 11-26-07: Product name changed and inference added /product="mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase PslB" /inference="similar to AA sequence:INSD:AAG05620.1" |
M. Lindeberg Cornell University |
175 | PSPTO_3531 | 11-26-07: Product name changed and inference added /product="lipoprotein PslD" /inference="similar to AA sequence:INSD:AAG05622.1" |
M. Lindeberg Cornell University |
174 | PSPTO_3532 | 11-26-07: Product name changed and inference added /product="exopolysaccharide biosythesis protein PslE" /inference="similar to AA sequence:INSD:AAG05623.1" |
M. Lindeberg Cornell University |
173 | PSPTO_3533 | 11-26-07: Product name changed and inference added /product="glycosyl transferase, group 1 family protein PslF" /inference="similar to AA sequence:INSD:AAG05624.1" |
M. Lindeberg Cornell University |
172 | PSPTO_3534 | 11-26-07: Product name changed and inference added /product="glycosyl hydrolase, family 5 PslG" /inference="similar to AA sequence:INSD:AAG05625.1" |
M. Lindeberg Cornell University |
171 | PSPTO_3535 | 11-26-07: Product name changed and inference added /product="glycosyl transferase, group 1 family protein PslH" /inference="similar to AA sequence:INSD:AAG05626.1" |
M. Lindeberg Cornell University |
170 | PSPTO_3536 | 11-26-07: Product name changed and inference added /product="glycosyl transferase, group 1 family protein PslI" /inference="similar to AA sequence:INSD:AAG05627.1" |
M. Lindeberg Cornell University |
169 | PSPTO_3537 | 11-26-07: Product name changed and inference added /product="membrane protein PslJ" /inference="similar to AA sequence:INSD:AAG05628.1" |
M. Lindeberg Cornell University |
168 | PSPTO_3539 | 11-26-07: Product name changed and inference added /product="membrane protein PslK" /inference="similar to AA sequence:INSD:AAG05629.1" |
M. Lindeberg Cornell University |
167 | PSPTO_4574 | 9-06-07: Coordinates changed |
M. Lindeberg Cornell University |
166 | PSPTO_4570 | 9-06-07: Product name and note fields changed Product name changed from "hypothetical protein" to "binary cytotoxin component, putative". Note field changed to /note="similar to GP:80558284; identified by sequence similarity; putative" |
M. Lindeberg Cornell University Based on literature review |
165 | PSPTO_4571 | 9-06-07: Product name and note fields changed Product name changed from "hypothetical protein" to "binary cytotoxin component, putative". Note field changed to /note="similar to GP:80558283; identified by sequence similarity; putative" |
M. Lindeberg Cornell University Based on literature review |
164 | PSPTO_4287 | 9-06-07: Product name and note fields changed Product name changed from "hypothetical protein" to "binary cytotoxin component, putative". Note field changed to /note="similar to GP:80558284; identified by sequence similarity; putative" |
M. Lindeberg Cornell University Based on literature review |
163 | PSPTO_5625 | 9-06-07: Gene and CDS features added gene 4827116..4828336 /locus_tag="PSPTO_5625" CDS 4827116..4828336 /locus_tag="PSPTO_5625" /note="similar to GP:80558283; identified by sequence similarity; putative" /codon_start=1 /transl_table=11 /product="binary cytotoxin component, putative" /protein_id="" /db_xref="" /translation="MLSQAALLENEDIARVTLKPVEYLSVILDDEKNGGRSAALILTREDILSLKRYERHALNI PTSLPRVEQQLGFTKSGIPGLEPKDMLVTYQAINNHGKSWLGIEDGIKRSGFAIDLFAAQ FSGQGQQIINYIEKMDFARQLDLTVADLTIEEVREKNPTPLGETDQKVCITLAAFLKKTA SQIKNHQHAAGTLAQHIDTFSTVLSVQLIPGINDKVKLARRSGLDQQLKELEKDIEQLTK EIEQKNKEYKFSMNNIAWGGFGGPIGVAITGGIFGAKAEKIRKEKNRMVDSKNQKVQTLK EKVPLAAAVRSLQILFEDMNIRMMDAHQSATHLKDLWTMLAAYIDSSANELAAITDDQAL MIFAMQFQGVVTPWLEIRGMTTQLLKIFDSALDQFQREQQPVVVVGR" |
M. Lindeberg Cornell University Based on literature review |
162 | PSPTO_5626 | 9-06-07: Gene feature added gene 5356088..5356525 /locus_tag="PSPTO_5626" /note="this region is disrupted by an IS element insertion, interruption-N; this region is similar to the N-terminal region of a transposase protein; identified by sequence similarity; putative" |
M. Lindeberg Cornell University |
161 | PSPTO_5627 | 9-06-07: Gene feature added gene 5358542..5359036 /locus_tag="PSPTO_5627" /note="this region is disrupted by an IS element insertion, interruption-C; this region is similar to the C-terminal region of a transposase protein; identified by sequence similarity; putative" /pseudo |
M. Lindeberg Cornell University |
160 | PSPTO_5628 | 9-06-07: Gene feature added gene 5359162..5359782 /locus_tag="PSPTO_5628" /note="This gene is disrupted by two IS element insertions; HopH protein, interruption-C; identified by sequence similarity; putative" /pseudo |
M. Lindeberg Cornell University |
159 | PSPTO_5623 | 9-06-07: Coordinates and note field changed |
M. Lindeberg Cornell University |
158 | PSPTO_5629 | 9-06-07: Gene and CDS features added 5334154..5335002 /locus_tag="PSPTO_5629" CDS complement(5328266..5329000) /locus_tag="PSPTO_5629" /note="residues 1-118 show similarity to ISPs1 OrfA and 84-237 to ISPsy13 OrfB; identified by sequence similarity; putative" /codon_start=1 /transl_table=11 /product="insertion sequence, putative" |
M. Lindeberg Cornell University |
157 | PSPTO_5630 | 9-06-07: Gene and CDS features added |
M. Lindeberg Cornell University |
156 | PSPTO_5162 | 9-06-07: Gene name corrected Gene name for PSPTO_5162 changed from MgoG to MdoG |
N. Panopoulos Univ of Crete Heraklion, Greece |
155 | PSPTO_2157 | 12-13-06: Change in coordinates and assignment of gene and product name |
B. Swingle USDA-ARS |
154 | PSPTO_1389 | 12-8-06: Coordinates corrected Coordinates for hrcC changed from 1529049..1530989 to 1528890..1530989. Translated product adjusted accordingly |
M. Lindeberg Cornell University |
153 | PSPTO_0827 | 11-21-06: CDS feature added and pseudogene designation removed |
G. Preston Oxford University |
152 | PSPTO_3817 | 11-21-06: CDS feature added and pseudogene designation removed /product="tRNA pseudouridine synthase A" |
G. Preston Oxford University |
151 | PSPTO_3840 | 11-21-06: CDS feature added and pseudogene designation removed /product="ribosomal large subunit pseudouridine synthase C" |
G. Preston Oxford University |
150 | PSPTO_3875 | 11-21-06: CDS feature added and pseudogene designation removed /product="ribosomal large subunit pseudouridine synthase A" |
G. Preston Oxford University |
149 | PSPTO_4247 | 11-21-06: CDS feature added and pseudogene designation removed /product="ribosomal small subunit pseudouridine synthase A" |
G. Preston Oxford University |
148 | PSPTO_4488 | 11-21-06: CDS feature added and pseudogene designation removed /product="tRNA pseudouridine synthase B" |
G. Preston Oxford University |
147 | PSPTO_0473 | 9-22-06: Change in feature designation misc_feature changed to gene with name "hopAS1" and /pseudo field added |
M. Lindeberg Cornell University |
146 | PSPTO_0474 | 9-22-06: Expanded note field /note="This region contains an authentic point mutation causing a premature stop and is not the result of a sequencing artifact; identified by sequence similarity to the N-terminal regions of HopAS1 in Pseudomonas syringae phaseolicola; previously known as ORF01152 (PMID 11854524; Fouts et al, 2002)” |
M. Lindeberg Cornell University |
145 | PSPTO_0904 | 9-22-06: CDS feature removed |
M. Lindeberg Cornell University |
144 | PSPTO_0904 | 9-22-06: Expanded note field for gene feature and addition of pseudo field /note="This region is disrupted by an IS element insertion, interruption-C; region is similar to the C-terminal region of HopAG1 in Pseudomonas syringae pv syringae; identified by match to PFAM protein family HMM PF00293" |
M. Lindeberg Cornell University |
143 | PSPTO_4591 | 9-22-06: Change in feature designation misc_feature changed to gene with name "hopO1-3" and /pseudo field added |
M. Lindeberg Cornell University |
142 | PSPTO_4597 | 9-22-06: Expanded note field /note="Previously known as holPtoZ (PMID 11872842; Guttman et al, 2002), HopPtoS4 (PMID 14702323; Schechter, 2004) ORF26 (PMID 12032338; Petnicki-Ocwieja et al, 2002).;similar to GP:19071536; identified by sequence similarity; putative; possibly truncated by ISPssy insertion" |
M. Lindeberg Cornell University |
141 | PSPTO_4724 | 9-22-06: Gene name added /gene="hopD" |
M. Lindeberg Cornell University |
140 | PSPTO_4724 | 9-22-06: New CDS feature |
M. Lindeberg Cornell University |
139 | PSPTO_4726 | 9-22-06: Addition of /pseudo field | M. Lindeberg Cornell University |
138 | PSPTO_1383 | 9-22-06: Nomenclature Gene name changed to "hrpB", product name changed to "type III secretion protein HrpB" |
M. Lindeberg Cornell University |
137 | PSPTO_1376 | 9-22-06: Nomenclature Gene name changed from "avrF" to "ShcE", product name changed from "type III chaperone AvrF" to "type III chaperone ShcE" |
M. Lindeberg Cornell University |
136 | PSPTO_1369 | 9-22-06: Geneand product name added /gene="shcN", /product="type III chaperone protein ShcN" |
M. Lindeberg Cornell University |
135 | PSPTO_4993 | 9-22-06: Expanded note field /note="This gene is disrupted by an IS element insertion, interruption-N; known as holPtoAC (PMID 12615215; Greenberg and Vinatzer, 2003) or HopAC (PMID 15828679;Lindeberg et al, 2005); not a type III effector" |
M. Lindeberg Cornell University |
134 | PSPTO_4996 | 9-22-06: Expanded note field /note="This gene is disrupted by an IS element insertion, interruption-C; previously known as holPtoAC (PMID 12615215; Greenberg and Vinatzer, 2003) or HopAC (PMID 15828679; Lindeberg et al, 2005); not a type III effector" |
M. Lindeberg Cornell University |
133 | PSPTO_1569 | 8-18-06: Gene and CDS features deleted | M. Lindeberg Cornell University |
132 | PSPTO_4598 | 8-18-06 Gene and CDS features deleted | M. Lindeberg Cornell University |
131 | PSPTO_5623 | 8-18-06: Gene and CDS features added misc_feature 5355978..5356064 /locus_tag="PSPTO_5623" /note="This region contains an authentic frame shift and is not the result of a sequencing artifact; This gene is disrupted by an IS element insertion.; HopH protein, interruption-N; identified by sequence similarity; putative" |
M. Lindeberg Cornell University |
130 | 8-8-06:
Promoter feature added promoter 1542129..1542182 /experiment="gel-shift assay" /note="putative CorR binding site; identified by gel-shift assays and sequence alignment; downstream gene(s) exhibit CorR-dependent diffential expression; PMID: 16838789" |
A. Sreedharen Oklahoma State University |
|
129 | 8-8-06:
Promoter feature added promoter 5330722..5330777 /note="putative CorR binding site; identified by sequence alignment; downstream gene(s) exhibit CorR-dependent diffential expression; PMID: 16838789" |
A. Sreedharen Oklahoma State University |
|
128 | PSPTO4732 | 8-8-06: Nomenclature Gene name changed from "holQ1-2" to "hopQ1-2" |
M. Lindeberg Cornell University |
127 | PSPTO1376 | 8-8-06: Product name changed Product name changed from "avirulence protein AvrF" to "Type III chaperone AvrF" |
M. Lindeberg Cornell University |
126 | PSPTO1374 | 5-06: Gene and product name added Gene name "shcM" added. Product name changed from "conserved effector locus protein" to "type III chaperone ShcM" |
M. Lindeberg |
125 | PSPTO4721 | 5-06: Gene and product name added Gene name "shcV" added. Product name changed from "hypothetical protein" to "type III chaperone ShcV" |
M. Lindeberg |
124 | PSPTO3576 | 5-06: Gene, product name, and functional information added ”mutations exhibit reduced disease symptoms and growth in planta; PMID 16267304” added to note qualifier |
M. Lindeberg |
123 | PSPTO5157 | 5-06: Functional information added "mutations exhibit reduced virulence; PMID 16321949" added to note qualifier |
M. Lindeberg Cornell University Based on literature review |
122 | PSPTO3292 | 3-06:
Gene and product name added Gene name "hopAH2-1" added. Product name changed from "hypothetical protein" to "type III effector HopAH2-1" Reference (PMID: 17073301) | Lisa
Schechter University of Missouri, St. Louis |
121 | PSPTO3293 | 3-06:
Gene and product name added Gene name "hopAH2-2" added. Product name changed from "hypothetical protein" to "type III effector HopAH2-2" Reference (PMID: 17073301) | Lisa
Schechter University of Missouri, St. Louis |
120 | PSPTO4589 | 3-06:
Gene and product name added Gene name "shcS2" added. Product name changed from "hypothetical protein" to "type III chaperone ShcS2" Reference (PMID: 17073301) | M.
Lindeberg |
119 | PSPTO4599 | 3-06:
Gene and product name added Gene name "shcS1" added. Product name changed from "hypothetical protein" to "type III chaperone ShcS1" Reference (PMID: 17073301) | M.
Lindeberg Cornell University Based on literature review |
118 | PSPTO0473 | 3-06:
Gene and CDS features replaced with misc_feature Gene and CDS features for this locus were deleted and replaced with: misc_feature complement(518079..521327) /note="PSPTO0473; this region contains an authentic point mutation causing a premature stop and is not the result of a sequencing artifact; identified by similarity to the C-terminal regions of HopAS1 in Pseudomonas syringae phaseolicola" | M.
Lindeberg Cornell University |
117 | PSPTO5616 | 3-06:
Gene and CDS features added gene complement(522206..522316) /locus_tag="PSPTO_5616" CDS complement(522206..522316) /locus_tag="PSPTO_5616" /note="similar to gene downstream of PSPPH4735" /codon_start=1 /transl_table=11 /product="conserved hypothetical protein" /protein_id="ABD93120.1" /db_xref="GI:90295593" /translation="MPPRQFEEVSPSAATALRTRFTHHRMRSVDYYHHLY" | D.
Schneider, USDA-ARS |
116 | PSPTO5618 | 3-06:
Gene feature added | D.
Schneider, USDA-ARS |
115 | PSPTO5621 |
3-06: Gene and CDS features
added gene 923360..923584 /locus_tag="PSPTO_5621" /note="conserved hypothetical gene; identified by sequence similarity" CDS 923360..923584 /locus_tag="PSPTO_5621" /note="identified by sequence similarity; N-terminus similar to carbon storage regulator proteins" /codon_start=1 /transl_table=11 /product="PSPTO5621" /protein_id="ABD93121.1" /db_xref="GI:90295594" /translation="MLLLTRREGENIVIGDGIQIQVLSVSEDTGDVRIQIEAPDVVEAQGRTAGNEVTDH KPGPVITHKRRWRSLVTQ" | D.
Schneider, USDA-ARS |
114 | PSPTO5617 |
3-06: Gene feature added gene complement(938980..939307) /locus_tag="PSPTO_5617" /note="This region contains a gene with one or more premature stops or frameshifts; conserved hypothetical gene; similar to GI:63255405, GI:68637911" /pseudo | D.
Schneider, USDA-ARS |
113 | PSPTO5619 |
3-06: Gene and CDS features
added gene 981249..981500 /locus_tag="PSPTO_5619" /note="hypothetical gene; identified by sequence similarity" CDS 981249..981500 /locus_tag="PSPTO_5619" /note="identified by sequence similarity" /codon_start=1 /transl_table=11 /product="PSPTO5619" /protein_id="ABD93122.1" /db_xref="GI:90295595" /translation="MDYLESIISSAYWQYLVRSGNWLLILSCLLSPSVIQDSAEPESG YVPREYRLTAVGPDNYHDACNAKDENSSRAPRRTRRSAQ" | D.
Schneider, USDA-ARS |
112 | PSPTO5622 |
3-06: Gene and CDS features
added gene 1548470..1548718 /locus_tag="PSPTO_5622" /note="conserved gene; similar to PSTO_B0005.1" CDS 1548470..1548718 /locus_tag="PSPTO_5622" /note="similar to PSPTO_B005.1" /codon_start=1 /transl_table=11 /product="PSPTO5622" /protein_id="ABD93123.1" /db_xref="GI:90295596" /translation="MKLKDICSKTKFIALASFAVLSLQMPLVHADGGAQLSGAQGQGS AALNSGSGQGGTAQSGSQSGSRDSSTCCTPTACITPCP" | D.
Schneider, USDA-ARS |
111 | PSPTO5620 |
3-06: Gene and CDS features
added gene complement(1731272..1731397) /locus_tag="PSPTO_5620" /note="identified by sequence similarity" CDS complement(1731272..1731397) /locus_tag="PSPTO_5620" /note="identified by sequence similarity" /codon_start=1 /transl_table=11 /product="PSPTO5620" /protein_id="ABD93124.1" /db_xref="GI:90295597" /translation="MRVSNCSAPVIKHTIRTCAAHSTLSSVAIEIQVSHHKRKAN" | D.
Schneider, USDA-ARS |
110 | PSPTO0590 | 3-06: Gene and CDS features deleted | D.
Schneider, USDA-AR |
109 | PSPTO0870 | 3-06: Gene and CDS features deleted | D.
Schneider, USDA-AR |
108 | PSPTO1569 | 3-06: Gene and CDS features deleted | D.
Schneider, USDA-AR |
107 | PSPTO4598 | 3-06: Gene and CDS features deleted | D.
Schneider, USDA-AR |
A tabular listing of the all hrp promoters added to the Pto DC3000 Genbank annotation can be viewed here | |||
106 | 3-06:
Promoter feature added promoter complement(61504..61536) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
105 | 3-06:
Promoter feature added promoter 82447..82478 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
104 | 3-06:
Promoter feature added promoter 404752..404784 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
103 | 3-06:
Promoter feature added promoter complement(522444..522475) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
102 | 3-06:
Promoter feature added promoter complement(550602..550634) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
101 | 3-06:
Promoter feature added promoter 572473..572504 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
100 | 3-06:
Promoter feature added promoter complement(648424..648456) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
99 | 3-06:
Promoter feature added promoter complement(649735..649766) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
98 | 3-06:
Promoter feature added promoter 905339..905371 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
97 | 3-06:
Promoter feature added promoter complement(921879..921911) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
96 | 3-06:
Promoter feature added promoter complement(939413..939445) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
95 | 3-06:
Promoter feature added promoter 941100..941132 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
94 | 3-06:
Promoter feature added promoter 946154..946185 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
93 | 3-06:
Promoter feature added promoter complement(949826..949858) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
92 | 3-06:
Promoter feature added promoter 954203..954234 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
91 | 3-06:
Promoter feature added promoter 981177..981208 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
90 | 3-06:
Promoter feature added promoter complement(1116378..1116410) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
89 | 3-06:
Promoter feature added promoter 1504886..1504917 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
88 | 3-06:
Promoter feature added promoter 1505219..1505251 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
87 | 3-06:
Promoter feature added promoter 1507652..1507684 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
86 | 3-06:
Promoter feature added promoter complement(1510785..1510816) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
85 | 3-06:
Promoter feature added promoter 1510881..1510913 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
84 | 3-06:
Promoter feature added promoter complement(1519570..1519601) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
83 | 3-06:
Promoter feature added promoter 1519666..1519697 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
82 | 3-06:
Promoter feature added promoter 1524204..1524236 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
81 | 3-06:
Promoter feature added promoter 1528184..1528216 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
80 | 3-06:
Promoter feature added promoter complement(1536874..1536905) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
79 | 3-06:
Promoter feature added promoter complement(1542621..1542653) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
78 | 3-06:
Promoter feature added promoter 1543416..1543447 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
77 | 3-06:
Promoter feature added promoter 1548389..1548420 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
76 | 3-06:
Promoter feature added promoter complement(1731421..1731453) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
75 | 3-06:
Promoter feature added promoter 2279883..2279915 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
74 | 3-06:
Promoter feature added promoter 2973825..2973856 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
73 | 3-06:
Promoter feature added promoter complement(3470185..3470217) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
72 | 3-06:
Promoter feature added promoter complement(3939658..3939690) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
71 | 3-06:
Promoter feature added promoter complement(4515296..4515328) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
70 | 3-06:
Promoter feature added promoter 4621129..4621160 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
69 | 3-06:
Promoter feature added promoter 4881097..4881129 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
68 | 3-06:
Promoter feature added promoter complement(5186123..5186154) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
67 | 3-06:
Promoter feature added promoter complement(5192613..5192644) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
66 | 3-06:
Promoter feature added promoter 5305220..5305252 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
65 | 3-06:
Promoter feature added promoter 5330688..5330720 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
64 | 3-06:
Promoter feature added promoter complement(5344375..5344407) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
63 | 3-06:
Promoter feature added promoter complement(5348578..5348610) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
62 | 3-06:
Promoter feature added promoter 5350034..5350065 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
61 | 3-06:
Promoter feature added promoter complement(5355224..5355256) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
60 | 3-06:
Promoter feature added promoter 5355530..5355562 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
59 | 3-06:
Promoter feature added promoter complement(5361707..5361739) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
58 | 3-06:
Promoter feature added promoter complement(5418197..5418228) /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
57 | 3-06:
Promoter feature added promoter 6085756..6085788 /experiment="microarray and/or RT-PCR" /note="hrp box; putative HrpL-dependent promoter; location identified by hidden Markov model and/or weight matrix scans; downstream gene(s) exhibit HrpL-dependent diffential expression" Reference (PMID: 17073300) | D.
Schneider, USDA-ARS | |
56 | all tRNA loci | 11-05:
product names added A qualifier in the format: /product="[name]" has been added to all tRNA features in the annotation | Genbank |
55 | PSPTO3914 |
11-05: Gene name added | P. Bronstein, M. Lindeberg, Cornell University |
54 | PSPTO3648 |
11-05: Gene name added | P. Bronstein, M. Lindeberg, Cornell University |
53 | PSPTO1377 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
52 |
PSPTO4001 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
51 |
PSPTO5354 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
50 |
PSPTO1406 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
49 |
PSPTO0589 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
48 |
PSPTO0876 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
47 |
PSPTO4724 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
46 |
PSPTO4726 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
45 |
PSPTO4331 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
44 |
PSPTO0502 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
43 |
PSPTO4727 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
42 |
PSPTO0588 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
41 |
PSPTO4691 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
40 |
PSPTO1568 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
39 |
PSPTO0044 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
38 |
PSPTO2872 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
37 |
PSPTO1375 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
36 |
PSPTO1370 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
35 |
PSPTO4592 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
34 |
PSPTO4591 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
33 |
PSPTO4594 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
32 |
PSPTO2678 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
31 |
PSPTO0877 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
30 |
PSPTO4732 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
29 |
PSPTO0883 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
28 |
PSPTO4597 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
27 |
PSPTO4588 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
26 |
PSPTO4593 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
25 |
PSPTO4590 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
24 |
PSPTO0501 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
23 |
PSPTO4720 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
22 |
PSPTO0061 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
21 |
PSPTO1372 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
20 |
PSPTO4718 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
19 |
PSPTO3087 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
18 |
PSPTO4691 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
17 |
PSPTO1568 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
16 |
PSPTO0901 | 3-05:
Nomenclature | M.
Lindeberg, Cornell University |
15 |
PSPTO0904 | 3-05:
Nomenclature | M.
Lindeberg, Cornell University |
14 |
PSPTO0905 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
13 |
PSPTO0906 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
12 |
PSPTO0852 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
11 |
PSPTO4817 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
10 |
PSPTO4101 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
9 |
PSPTO1022 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
8 |
PSPTO5061 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
7 |
PSPTO4722 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
6 |
PSPTO4703 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
5 |
PSPTO0474 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
4 |
PSPTO1381 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
3 |
PSPTO1405 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
2 |
PSPTO1373 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |
1 |
PSPTO1382 |
3-05: Nomenclature | M.
Lindeberg, Cornell University |